PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01245.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 434aa    MW: 48349.1 Da    PI: 6.9814
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01245.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-16106151147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
       KHN01245.1 106 RGHWRPAEDSKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 151
                      899*****************************.***********996 PP

2Myb_DNA-binding55.51.3e-17158201146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
       KHN01245.1 158 RRAFSEEEEERLMQAHRIYGNK-WAMIARLFP-GRTDNAVKNHWHV 201
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.17101152IPR017930Myb domain
SMARTSM007172.9E-14105154IPR001005SANT/Myb domain
PfamPF002499.0E-16106151IPR001005SANT/Myb domain
SuperFamilySSF466898.24E-28106199IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-25107159IPR009057Homeodomain-like
CDDcd001673.25E-13109150No hitNo description
PROSITE profilePS5129426.929153207IPR017930Myb domain
SMARTSM007171.8E-14157205IPR001005SANT/Myb domain
PfamPF002492.5E-14158200IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-20160206IPR009057Homeodomain-like
CDDcd001679.92E-12160200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MMGSLSLATV SNNASSSQES NVYGYGYGYA SGVGNGSTRW SFPFMREFLS SNFEDCSDLV  60
GAGESNNSNE KTNHNNGKFS EEESNPNENH ANGKEVDSGH SKLCARGHWR PAEDSKLKEL  120
VALYGPQNWN LIAEKLEGRS GKSCRLRWFN QLDPRINRRA FSEEEEERLM QAHRIYGNKW  180
AMIARLFPGR TDNAVKNHWH VIMARKYREQ SSAYRRRRMS QSVHRRVEQN PTFVCSSSRD  240
NASTTEQEPE PSPSYYPNLI HHGVALTNNM ASFPPFHGVA ACNGVVVEFG SNGSPQNMTS  300
GREAMPNTTH VGLSAQAQQQ APFDFFSGGG SNDIVLESIS HMRSRERTNG SHNHHCQLSG  360
CYPHYPQQYL MAMQQQLDNN NNFYSFLNSS PAASTAREPS SSPCVAEIRD KVENSDPPDG  420
VPPPFFDFLG VGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-341062067107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006573117.10.0PREDICTED: uncharacterized protein LOC100776292
TrEMBLK7K1V80.0K7K1V8_SOYBN; Uncharacterized protein
STRINGGLYMA01G05980.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.15e-75myb domain protein 105